.
19,258 domains match your criteria
Domain Company Country Category IAB Category Rank Monthly Visits
danwarnerrxp.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
yourmentalage.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
cobookstore.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
georgiapines.net - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
outgoingmotorboat.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
riveonhealth.org - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
amelie-schomburg.de - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
carolinawellnesspsychiatry.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
azurkineziologia.hu - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
longsoulsystem.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
sabrrwellnessretreat.in - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
trastornosmentales.org - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
opuntiamente.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
psicologiaintegralpma.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
alittlehopetoday.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
makehumanhealthy.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
possitivevibes.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
imanipsicologia.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
mhasck.org - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
milenameira.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
sollushealth.com - - /Health/Mental Health/Depression Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
psiquiatranathaliaarruda.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
ninapsiquiatria.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
hypnose-mons-bruxelles.be - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
drannagorgolewska.pl - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
drchanchungmau.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
notenest.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
kmcollaborative.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
egosynthesis.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
livingspringfamilypsychiatry.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
popaia.fr - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
cityhillwellness.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
valleywell.net - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
healthdaq.co - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
timewellnessar.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
centrumleczeniatraumy.pl - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
srheumatology.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
psychiatryarkansas.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
creativecontinuumaz.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
noestassoloweb.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
draisabellasa.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
cosgrovepsychiatry.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
mfmhealth.com - - /Health/Mental Health/Depression Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
advantagesofmediation.ca - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
gulsenunlu.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
centerhelp.net - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
dynamicpsychiatryutah.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
aipc-elgin.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
cmhakelowna.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
glimermind.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
destahealth.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
voxmindhealthtr.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
smarthypnotherapi.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
peppertreehypno.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
harmony-ggz.nl - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
bozemancounseling.org - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
tigaratus14.click - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
narumi-kokoro.jp - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
dnhtc.org - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
gracemindcare.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
redsandspsychandcounseling.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
psychiatrie-connect.de - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
renewpsychiatry.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
lourdestomas.com Dra. Lourdes Tomรกs US /Health/Mental Health/Anxiety & Stress Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
clinicaltriallink.ai - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
soulbol.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
psychologykeys.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
cliniscripts.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
mariannalucibello.it - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
dottoressateresapetrarcanpia.it - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
southjerseymentalhealth.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
warmehaende.de - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
bsr-mandala.nl - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
reequilibre.net - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
aelyzecreates.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
np-psychiatry.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
stridestherapies.ca - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
chrysaliscaretaker.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
um.app - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
prismaticcompassion.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
mymemorylift.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
chawc.org - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
tigaratus16.click - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
eclipsetulsa.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
rm.org - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
restorepsychwellness.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
neuroessence.co - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
balancedmindspsychandtmbw.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
hakanbalibey.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
affirmationsmentalhealth.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
institutbrain360.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
creativehealingpsychiatry.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
gulsedaayranci.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
mindu.de - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
christinabellin.ch - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
valleydeepcounseling.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
optionspa.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
balancedminds.cc - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
markbehavioral.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -
driftbehavioral.com - - /Health/Mental Health Mental Health/Medical Health/Diseases and Conditions/Mental Health - -