.
3,040 domains match your criteria
Domain Company Country Category IAB Category Rank Monthly Visits
haywardmoon.co.uk - - /Real Estate - - -
haycastletrust.org - - /Business & Industrial/Hospitality Industry Hospitality Industry/Business and Finance/Industries/Hospitality Industry - -
haynesfineart.com - - /Arts & Entertainment/Visual Art & Design/Painting Painting/Hobbies & Interests/Arts and Crafts/Painting - -
haysmac.com - - /Finance/Accounting & Auditing Business Accounting & Finance/Business and Finance/Business/Business Accounting & Finance - -
haycambridge.co.uk - - Arts & Entertainment/Events & Listings - - -
haylingferry.net - - /Travel/Cruises & Charters Cruises/Travel/Travel Type/Cruises - -
haycambspboro.co.uk - - /Arts & Entertainment/Events & Listings - - -
hayesstreetfarmbootfairs.co.uk - - /Shopping/Apparel/Footwear - - -
hayletowncouncil.net - - /Law & Government/Government - - -
hayvansahiplenme.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
haydamaka-shop.com - - /Hobbies & Leisure/Crafts Arts and Crafts/Hobbies & Interests/Arts and Crafts - -
haymanjoycebroadway.co.uk - - /Real Estate/Real Estate Services - - -
haydemusic.com - - /Arts & Entertainment/Music & Audio - - -
hayashop.net - - /Shopping/Apparel/Women's Clothing Women's Clothing/Style & Fashion/Women's Fashion/Women's Clothing - -
haydenvision.com - - /Health/Vision Care - - -
haymarketdentalstudio.com - - /Health/Oral & Dental Care Oral care/Style & Fashion/Personal Care/Oral care - -
hayesproducts.co.uk - - /Home & Garden/Home Improvement/Construction & Power Tools Home Improvement/Home & Garden/Home Improvement - -
hayteks.biz.tr - - /Business & Industrial/Textiles & Nonwovens - - -
haysouthcambs.co.uk - - /Arts & Entertainment/Events & Listings - - -
hayter.co.uk - - /Home & Garden/Yard & Patio/Lawn Mowers - - -
hayfenland.co.uk - - Arts & Entertainment/Events & Listings - - -
hayondepanneure.fr - - /Business & Industrial - - -
haylingdonkeys.co.uk - - /Hobbies & Leisure - - -
hayashi.at - - /Arts & Entertainment/Events & Listings/Restaurants - - -
haymanpartners.info - - Business & Industrial/Business Services/Real Estate - - -
haydeidrilling.co.uk - - /Business & Industrial/Energy & Utilities Power and Energy Industry/Business and Finance/Industries/Power and Energy Industry - -
hayalashes.store - - /Home & Garden/Domestic Services/Cleaning Services - - -
hayhurstlaw.com - - /Law & Government/Legal/Legal Services Legal Services Industry/Business and Finance/Industries/Legal Services Industry - -
hayleysaventura.com - - /Business & Industrial/Chemicals Industry - - -
haystreetlegal.com.au - - /Law & Government/Legal/Legal Services Legal Services Industry/Business and Finance/Industries/Legal Services Industry - -
haydamac.com - - /Games - - -
hayato1111yayo.com - - Business & Industrial - - -
hayfieldwind.com - - /Hobbies & Leisure - - -
hayleybarwickhypno.com.au - - /People & Society/Social Sciences/Psychology - - -
hayesandwhite.co.uk - - /Home & Garden - - -
haytonfarmsberries.com - - /Business & Industrial/Agriculture & Forestry Agriculture/Business and Finance/Industries/Agriculture - -
hayescdjrlawrencevillevip.com - - /Autos & Vehicles/Motor Vehicles (By Type)/Trucks & SUVs - - -
haydencharlesdentalcare.com - - /Health/Oral & Dental Care Oral care/Style & Fashion/Personal Care/Oral care - -
haywoodarts.org - - /Arts & Entertainment - - -
hayakawa-home.com - - /Real Estate/Real Estate Listings/Residential Sales - - -
hayatina.fr - - /People & Society/Religion & Belief - - -
hayetkhyare.com - - /People & Society - - -
hayirlokmacisiantalya.com - - /Arts & Entertainment/Events & Listings/Bars, Clubs & Nightlife Bars & Restaurants/Attractions/Bars & Restaurants - -
haystackmrd.com - - /Arts & Entertainment/Online Media - - -
hayaluxurystudios.com - - /Travel/Hotels & Accommodations/Vacation Rentals & Short-Term Stays - - -
hayder.store - - /Health/Health Conditions/Pain Management - - -
hayleybonnick.com - - /Business & Industrial/Business Services - - -
haycreekentertainment.com - - /Arts & Entertainment - - -
haylo3dimaging.com - - /Health/Reproductive Health Reproductive Health/Medical Health/Diseases and Conditions/Reproductive Health - -
hayessignaturelighting.com - - /Home & Garden/Home Furnishings/Lamps & Lighting - - -
hayashi-united.co.jp - - /Business & Industrial - - -
hayikamacarpetwashingmachine.com - - /Home & Garden/Domestic Services/Cleaning Services - - -
haywoodcarpentry.com.au - - /Home & Garden/Home Improvement Home Improvement/Home & Garden/Home Improvement - -
hayrmenia.nl - - /Shopping - - -
haykalpart.com - - /Autos & Vehicles/Vehicle Parts & Services Auto Parts/Automotive/Auto Parts - -
haywoodmade.com - - /Arts & Entertainment/Visual Art & Design/Design Design/Fine Art/Design - -
haydetail.ru - - /Autos & Vehicles/Motor Vehicles (By Type)/Hybrid & Alternative Vehicles Green Vehicles/Automotive/Auto Type/Green Vehicles - -
hayattrafik.com - - /Business & Industrial/Transportation & Logistics/Parking - - -
hayotech.com - - /Arts & Entertainment/Visual Art & Design/Design Design/Fine Art/Design - -
haystackers.com - - /Business & Industrial/Agriculture & Forestry/Agricultural Equipment - - -
hayashiwhisky.com - - /Food & Drink/Beverages/Alcoholic Beverages Alcoholic Beverages/Food & Drink/Alcoholic Beverages - -
hayabi.ru - - /Food & Drink - - -
hayliving.com - - /Arts & Entertainment/Visual Art & Design - - -
hayatona-store.com - - /Health/Nutrition Nutrition/Healthy Living/Nutrition - -
hayajiexports.com - - /Autos & Vehicles/Vehicle Shopping Auto Buying and Selling/Automotive/Auto Buying and Selling - -
haywardstudentliving.com - - /Real Estate/Real Estate Listings/Residential Rentals - - -
haydenroulston.co.nz - - /Real Estate/Real Estate Listings/Residential Sales - - -
hayrinigorekspertiz.com - - /Autos & Vehicles/Vehicle Shopping Auto Buying and Selling/Automotive/Auto Buying and Selling - -
haysrecruiting.com - - /Business & Industrial/Business Operations Business Operations/Business and Finance/Business/Business Operations - -
hayat.org.sa - - /People & Society/Social Issues & Advocacy/Charity & Philanthropy - - -
haydroplex.co.il - - /Beauty & Fitness/Hair Care/Hair Loss Hair Care/Style & Fashion/Beauty/Hair Care - -
haydikarfan.my - - /Arts & Entertainment - - -
haya-zumbafit.com - - /Jobs & Education/Education - - -
haymont.com.au - - /Real Estate/Real Estate Listings/Lots & Land - - -
hayroofing.co.uk - - /Home & Garden/Home Improvement Home Improvement/Home & Garden/Home Improvement - -
haym.info - - /Computers & Electronics/Computer Hardware/Desktop Computers Desktops/Technology & Computing/Computing/Desktops - -
hayee.cz - - /Travel - - -
haynesdigitalsystems.com - - /Business & Industrial - - -
hayzamroaster.com - - /Food & Drink/Beverages/Coffee & Tea - - -
haywardgroup.org.uk - - /Health - - -
hayeselectricite.fr - - Business & Industrial/Business Services - - -
hayat-smile.ru - - /Health/Oral & Dental Care Oral care/Style & Fashion/Personal Care/Oral care - -
hayes19coinlaundry.com - - /Home & Garden/Bed & Bath - - -
hayaisushi.nl - - /Food & Drink/Restaurants - - -
hayatliverychicago.com - - /Travel/Car Rental & Taxi Services - - -
haydennottinghill.com - - /Food & Drink/Restaurants - - -
haynesplumbing.net - - /Home & Garden/Home Improvement/Plumbing Home Improvement/Home & Garden/Home Improvement - -
hayerhealth.ca - - /Health/Medical Facilities & Services/Physical Therapy - - -
hayawaza.co.jp - - /Finance/Accounting & Auditing Business Accounting & Finance/Business and Finance/Business/Business Accounting & Finance - -
haysexcavating.com - - /Business & Industrial/Construction & Maintenance/Building Materials & Supplies - - -
hayattgroup.ae - - /Home & Garden/Home Improvement Home Improvement/Home & Garden/Home Improvement - -
hayesservicesct.com - - /Business & Industrial/Energy & Utilities Power and Energy Industry/Business and Finance/Industries/Power and Energy Industry - -
haygoodformayor.com - - /Jobs & Education - - -
hayat-eatery.ch - - /Food & Drink/Restaurants - - -
hayaustralia.com.au - - /Business & Industrial/Agriculture & Forestry Agriculture/Business and Finance/Industries/Agriculture - -
haycocksgarage.co.uk - - /Autos & Vehicles/Vehicle Parts & Services/Vehicle Repair & Maintenance Auto Repair/Automotive/Auto Repair - -
haycpas.com - - /Finance/Accounting & Auditing Business Accounting & Finance/Business and Finance/Business/Business Accounting & Finance - -
hayde.no - - /Arts & Entertainment/Music & Audio/Country Music Country Music/Music/Country Music - -
hayundios.com - - /People & Society/Religion & Belief - - -
haydenhomestudio.com - - /Arts & Entertainment/Visual Art & Design/Design Design/Fine Art/Design - -